PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000266683
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 191aa    MW: 22084.2 Da    PI: 4.7184
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000266683genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.8e-15956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd +l d+++ +G+g W+++ +  g++R++k+c++rw +yl
    MDP0000266683  9 KGLWTVEEDRILTDYIRVHGKGKWNRVNKVTGLKRSGKSCRLRWMNYL 56
                     678*******************************************97 PP

2Myb_DNA-binding36.98.6e-126298139
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39
                     r  +++eEd+l+++++++ G++ W++Ia +++ gRt++q
    MDP0000266683 62 RSDFSEEEDDLIIRLHNLIGNR-WSLIAGRVP-GRTDNQ 98
                     6789******************.*********.*****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.769460IPR017930Myb domain
SuperFamilySSF466893.13E-27798IPR009057Homeodomain-like
SMARTSM007171.5E-12858IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-211063IPR009057Homeodomain-like
PfamPF139211.5E-141271No hitNo description
CDDcd001672.35E-101256No hitNo description
PROSITE profilePS5129411.43561111IPR017930Myb domain
SMARTSM007174.0E-561105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-186498IPR009057Homeodomain-like
CDDcd001671.97E-76598No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MEGGNEXKKG LWTVEEDRIL TDYIRVHGKG KWNRVNKVTG LKRSGKSCRL RWMNYLSPSV  60
KRSDFSEEED DLIIRLHNLI GNRWSLIAGR VPGRTDNQSN SELQPLPNSD SNSKIFGDHE  120
AAAAIDEFDD EMMNIQDHIG STSEVGFSGM WEATMMSNDK FWFHSDDLNQ YSPYLWDPTL  180
DDHYPFQFDN L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-21997794B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.139891e-156fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008351800.11e-133PREDICTED: transcription factor WER-like
SwissprotQ9SEI03e-53WER_ARATH; Transcription factor WER
TrEMBLM5WAK57e-94M5WAK5_PRUPE; Uncharacterized protein
STRINGVIT_17s0000g08480.t017e-58(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.14e-54myb domain protein 66